Anti SLC25A35 pAb (ATL-HPA051720)

Atlas Antibodies

Catalog No.:
ATL-HPA051720-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 25, member 35
Gene Name: SLC25A35
Alternative Gene Name: FLJ40217
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018740: 95%, ENSRNOG00000004668: 96%
Entrez Gene ID: 399512
Uniprot ID: Q3KQZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSSTQLCTFSSTKDLLSQ
Gene Sequence IYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSSTQLCTFSSTKDLLSQ
Gene ID - Mouse ENSMUSG00000018740
Gene ID - Rat ENSRNOG00000004668
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC25A35 pAb (ATL-HPA051720)
Datasheet Anti SLC25A35 pAb (ATL-HPA051720) Datasheet (External Link)
Vendor Page Anti SLC25A35 pAb (ATL-HPA051720) at Atlas Antibodies

Documents & Links for Anti SLC25A35 pAb (ATL-HPA051720)
Datasheet Anti SLC25A35 pAb (ATL-HPA051720) Datasheet (External Link)
Vendor Page Anti SLC25A35 pAb (ATL-HPA051720)