Anti SLC25A27 pAb (ATL-HPA069732)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069732-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SLC25A27
Alternative Gene Name: FLJ33552, UCP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023912: 89%, ENSRNOG00000010592: 86%
Entrez Gene ID: 9481
Uniprot ID: O95847
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFL |
| Gene Sequence | MQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFL |
| Gene ID - Mouse | ENSMUSG00000023912 |
| Gene ID - Rat | ENSRNOG00000010592 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC25A27 pAb (ATL-HPA069732) | |
| Datasheet | Anti SLC25A27 pAb (ATL-HPA069732) Datasheet (External Link) |
| Vendor Page | Anti SLC25A27 pAb (ATL-HPA069732) at Atlas Antibodies |
| Documents & Links for Anti SLC25A27 pAb (ATL-HPA069732) | |
| Datasheet | Anti SLC25A27 pAb (ATL-HPA069732) Datasheet (External Link) |
| Vendor Page | Anti SLC25A27 pAb (ATL-HPA069732) |