Anti SLC25A27 pAb (ATL-HPA069732)

Atlas Antibodies

SKU: ATL-HPA069732-25

• 

Protein Description: solute carrier family 25, member 27
Gene Name: SLC25A27
Alternative Gene Name: FLJ33552, UCP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023912: 89%, ENSRNOG00000010592: 86%
Entrez Gene ID: 9481
Uniprot ID: O95847
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFL
• Gene Sequence: MQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFL
• Gene ID - Mouse: ENSMUSG00000023912
• Gene ID - Rat: ENSRNOG00000010592
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.