Anti SLC25A22 pAb (ATL-HPA014662)

Atlas Antibodies

Catalog No.: ATL-HPA014662-25

Protein Description: solute carrier family 25 (mitochondrial carrier: glutamate), member 22
Gene Name: SLC25A22
Alternative Gene Name: EIEE3, FLJ13044, GC1, NET44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019082: 98%, ENSRNOG00000018450: 94%
Entrez Gene ID: 79751
Uniprot ID: Q9H936
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVE
• Gene Sequence: RSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVE
• Gene ID - Mouse: ENSMUSG00000019082
• Gene ID - Rat: ENSRNOG00000018450
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC25A22 pAb (ATL-HPA014662) – 1 Found

Guo, Jingtao; Grow, Edward J; Mlcochova, Hana; Maher, Geoffrey J; Lindskog, Cecilia; Nie, Xichen; Guo, Yixuan; Takei, Yodai; Yun, Jina; Cai, Long; Kim, Robin; Carrell, Douglas T; Goriely, Anne; Hotaling, James M; Cairns, Bradley R. The adult human testis transcriptional cell atlas. Cell Research. 2018;28(12):1141-1157.