Anti SLC25A20 pAb (ATL-HPA029863)

Atlas Antibodies

Catalog No.: ATL-HPA029863-25

Protein Description: solute carrier family 25 (carnitine/acylcarnitine translocase), member 20
Gene Name: SLC25A20
Alternative Gene Name: CAC, CACT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032602: 93%, ENSRNOG00000020288: 89%
Entrez Gene ID: 788
Uniprot ID: O43772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMI
• Gene Sequence: SGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMI
• Gene ID - Mouse: ENSMUSG00000032602
• Gene ID - Rat: ENSRNOG00000020288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC25A20 pAb (ATL-HPA029863) – 1 Found

Häggmark, Anna; Mikus, Maria; Mohsenchian, Atefeh; Hong, Mun-Gwan; Forsström, Björn; Gajewska, Beata; Barańczyk-Kuźma, Anna; Uhlén, Mathias; Schwenk, Jochen M; Kuźma-Kozakiewicz, Magdalena; Nilsson, Peter. Plasma profiling reveals three proteins associated to amyotrophic lateral sclerosis. Annals Of Clinical And Translational Neurology. 2014;1(8):544-53.