Anti SLC25A20 pAb (ATL-HPA029863)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029863-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SLC25A20
Alternative Gene Name: CAC, CACT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032602: 93%, ENSRNOG00000020288: 89%
Entrez Gene ID: 788
Uniprot ID: O43772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMI |
| Gene Sequence | SGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMI |
| Gene ID - Mouse | ENSMUSG00000032602 |
| Gene ID - Rat | ENSRNOG00000020288 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC25A20 pAb (ATL-HPA029863) | |
| Datasheet | Anti SLC25A20 pAb (ATL-HPA029863) Datasheet (External Link) |
| Vendor Page | Anti SLC25A20 pAb (ATL-HPA029863) at Atlas Antibodies |
| Documents & Links for Anti SLC25A20 pAb (ATL-HPA029863) | |
| Datasheet | Anti SLC25A20 pAb (ATL-HPA029863) Datasheet (External Link) |
| Vendor Page | Anti SLC25A20 pAb (ATL-HPA029863) |
| Citations for Anti SLC25A20 pAb (ATL-HPA029863) – 1 Found |
| Häggmark, Anna; Mikus, Maria; Mohsenchian, Atefeh; Hong, Mun-Gwan; Forsström, Björn; Gajewska, Beata; Barańczyk-Kuźma, Anna; Uhlén, Mathias; Schwenk, Jochen M; Kuźma-Kozakiewicz, Magdalena; Nilsson, Peter. Plasma profiling reveals three proteins associated to amyotrophic lateral sclerosis. Annals Of Clinical And Translational Neurology. 2014;1(8):544-53. PubMed |