Anti SLC25A20 pAb (ATL-HPA016862 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA016862-25

Protein Description: solute carrier family 25 (carnitine/acylcarnitine translocase), member 20
Gene Name: SLC25A20
Alternative Gene Name: CAC, CACT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032602: 93%, ENSRNOG00000020288: 98%
Entrez Gene ID: 788
Uniprot ID: O43772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYR
• Gene Sequence: TVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYR
• Gene ID - Mouse: ENSMUSG00000032602
• Gene ID - Rat: ENSRNOG00000020288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC25A20 pAb (ATL-HPA016862 w/enhanced validation) – 1 Found

Tachibana, Keisuke; Takeuchi, Kentaro; Inada, Hirohiko; Yamasaki, Daisuke; Ishimoto, Kenji; Tanaka, Toshiya; Hamakubo, Takao; Sakai, Juro; Kodama, Tatsuhiko; Doi, Takefumi. Regulation of the human SLC25A20 expression by peroxisome proliferator-activated receptor alpha in human hepatoblastoma cells. Biochemical And Biophysical Research Communications. 2009;389(3):501-5.