Anti SLC25A17 pAb (ATL-HPA052708)

Atlas Antibodies

SKU: ATL-HPA052708-25

• 

Protein Description: solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
Gene Name: SLC25A17
Alternative Gene Name: PMP34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022404: 97%, ENSRNOG00000018920: 97%
Entrez Gene ID: 10478
Uniprot ID: O43808
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR
• Gene Sequence: TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR
• Gene ID - Mouse: ENSMUSG00000022404
• Gene ID - Rat: ENSRNOG00000018920
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.