Anti SLC25A17 pAb (ATL-HPA052708)

Atlas Antibodies

Catalog No.:
ATL-HPA052708-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17
Gene Name: SLC25A17
Alternative Gene Name: PMP34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022404: 97%, ENSRNOG00000018920: 97%
Entrez Gene ID: 10478
Uniprot ID: O43808
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR
Gene Sequence TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR
Gene ID - Mouse ENSMUSG00000022404
Gene ID - Rat ENSRNOG00000018920
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC25A17 pAb (ATL-HPA052708)
Datasheet Anti SLC25A17 pAb (ATL-HPA052708) Datasheet (External Link)
Vendor Page Anti SLC25A17 pAb (ATL-HPA052708) at Atlas Antibodies

Documents & Links for Anti SLC25A17 pAb (ATL-HPA052708)
Datasheet Anti SLC25A17 pAb (ATL-HPA052708) Datasheet (External Link)
Vendor Page Anti SLC25A17 pAb (ATL-HPA052708)