Anti SLC25A17 pAb (ATL-HPA052708)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052708-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SLC25A17
Alternative Gene Name: PMP34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022404: 97%, ENSRNOG00000018920: 97%
Entrez Gene ID: 10478
Uniprot ID: O43808
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR |
| Gene Sequence | TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR |
| Gene ID - Mouse | ENSMUSG00000022404 |
| Gene ID - Rat | ENSRNOG00000018920 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC25A17 pAb (ATL-HPA052708) | |
| Datasheet | Anti SLC25A17 pAb (ATL-HPA052708) Datasheet (External Link) |
| Vendor Page | Anti SLC25A17 pAb (ATL-HPA052708) at Atlas Antibodies |
| Documents & Links for Anti SLC25A17 pAb (ATL-HPA052708) | |
| Datasheet | Anti SLC25A17 pAb (ATL-HPA052708) Datasheet (External Link) |
| Vendor Page | Anti SLC25A17 pAb (ATL-HPA052708) |