Anti SLC22A6 pAb (ATL-HPA074559 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA074559-25
  • Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-SLC22A6 antibody. Corresponding SLC22A6 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 22 member 6
Gene Name: SLC22A6
Alternative Gene Name: OAT1, PAHT, ROAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024650: 41%, ENSRNOG00000018215: 47%
Entrez Gene ID: 9356
Uniprot ID: Q4U2R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTQKEAGIYPRKGKQTRQQQEHQKYMVPLQASAQ
Gene Sequence PTQKEAGIYPRKGKQTRQQQEHQKYMVPLQASAQ
Gene ID - Mouse ENSMUSG00000024650
Gene ID - Rat ENSRNOG00000018215
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC22A6 pAb (ATL-HPA074559 w/enhanced validation)
Datasheet Anti SLC22A6 pAb (ATL-HPA074559 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC22A6 pAb (ATL-HPA074559 w/enhanced validation)