Anti SLC22A18 pAb (ATL-HPA071461 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA071461-25

Protein Description: solute carrier family 22, member 18
Gene Name: SLC22A18
Alternative Gene Name: BWR1A, BWSCR1A, IMPT1, ITM, ORCTL2, SLC22A1L, TSSC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000154: 54%, ENSRNOG00000020562: 49%
Entrez Gene ID: 5002
Uniprot ID: Q96BI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI
• Gene Sequence: PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI
• Gene ID - Mouse: ENSMUSG00000000154
• Gene ID - Rat: ENSRNOG00000020562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.