Anti SLC22A18 pAb (ATL-HPA071461 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA071461-25
  • Immunohistochemistry analysis in human small intestine and liver tissues using Anti-SLC22A18 antibody. Corresponding SLC22A18 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: solute carrier family 22, member 18
Gene Name: SLC22A18
Alternative Gene Name: BWR1A, BWSCR1A, IMPT1, ITM, ORCTL2, SLC22A1L, TSSC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000154: 54%, ENSRNOG00000020562: 49%
Entrez Gene ID: 5002
Uniprot ID: Q96BI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI
Gene Sequence PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI
Gene ID - Mouse ENSMUSG00000000154
Gene ID - Rat ENSRNOG00000020562
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC22A18 pAb (ATL-HPA071461 w/enhanced validation)
Datasheet Anti SLC22A18 pAb (ATL-HPA071461 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC22A18 pAb (ATL-HPA071461 w/enhanced validation)