Anti SLC22A1 pAb (ATL-HPA029846)

Atlas Antibodies

Catalog No.: ATL-HPA029846-25

Protein Description: solute carrier family 22 (organic cation transporter), member 1
Gene Name: SLC22A1
Alternative Gene Name: OCT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023829: 74%, ENSRNOG00000016337: 78%
Entrez Gene ID: 6580
Uniprot ID: O15245
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFIL
• Gene Sequence: PRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFIL
• Gene ID - Mouse: ENSMUSG00000023829
• Gene ID - Rat: ENSRNOG00000016337
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.