Anti SLC1A7 pAb (ATL-HPA049124)

Atlas Antibodies

Catalog No.:
ATL-HPA049124-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: solute carrier family 1 (glutamate transporter), member 7
Gene Name: SLC1A7
Alternative Gene Name: EAAT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008932: 87%, ENSRNOG00000011644: 89%
Entrez Gene ID: 6512
Uniprot ID: O00341
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLVEATFKQYRTKTTPVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGM
Gene Sequence NLVEATFKQYRTKTTPVVKSPKVAPEEAPPRRILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGM
Gene ID - Mouse ENSMUSG00000008932
Gene ID - Rat ENSRNOG00000011644
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC1A7 pAb (ATL-HPA049124)
Datasheet Anti SLC1A7 pAb (ATL-HPA049124) Datasheet (External Link)
Vendor Page Anti SLC1A7 pAb (ATL-HPA049124) at Atlas Antibodies

Documents & Links for Anti SLC1A7 pAb (ATL-HPA049124)
Datasheet Anti SLC1A7 pAb (ATL-HPA049124) Datasheet (External Link)
Vendor Page Anti SLC1A7 pAb (ATL-HPA049124)