Anti SLC17A1 pAb (ATL-HPA050513)

Atlas Antibodies

Catalog No.: ATL-HPA050513-25

Protein Description: solute carrier family 17 (organic anion transporter), member 1
Gene Name: SLC17A1
Alternative Gene Name: NAPI-1, NPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021335: 63%, ENSRNOG00000042692: 51%
Entrez Gene ID: 6568
Uniprot ID: Q14916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI
• Gene Sequence: CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI
• Gene ID - Mouse: ENSMUSG00000021335
• Gene ID - Rat: ENSRNOG00000042692
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.