Anti SLC17A1 pAb (ATL-HPA050513)

Atlas Antibodies

Catalog No.:
ATL-HPA050513-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 17 (organic anion transporter), member 1
Gene Name: SLC17A1
Alternative Gene Name: NAPI-1, NPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021335: 63%, ENSRNOG00000042692: 51%
Entrez Gene ID: 6568
Uniprot ID: Q14916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI
Gene Sequence CLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDI
Gene ID - Mouse ENSMUSG00000021335
Gene ID - Rat ENSRNOG00000042692
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC17A1 pAb (ATL-HPA050513)
Datasheet Anti SLC17A1 pAb (ATL-HPA050513) Datasheet (External Link)
Vendor Page Anti SLC17A1 pAb (ATL-HPA050513) at Atlas Antibodies

Documents & Links for Anti SLC17A1 pAb (ATL-HPA050513)
Datasheet Anti SLC17A1 pAb (ATL-HPA050513) Datasheet (External Link)
Vendor Page Anti SLC17A1 pAb (ATL-HPA050513)