Anti SLC16A9 pAb (ATL-HPA049286)

Atlas Antibodies

Catalog No.:
ATL-HPA049286-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 16, member 9
Gene Name: SLC16A9
Alternative Gene Name: C10orf36, FLJ43803, MCT9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037762: 60%, ENSRNOG00000049063: 60%
Entrez Gene ID: 220963
Uniprot ID: Q7RTY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQSSDCPLPKKIAPEDLPDKYSIYNEKGKNLEENINILDKSYSSEEKCRITLANGDWKQDSLLHK
Gene Sequence LQSSDCPLPKKIAPEDLPDKYSIYNEKGKNLEENINILDKSYSSEEKCRITLANGDWKQDSLLHK
Gene ID - Mouse ENSMUSG00000037762
Gene ID - Rat ENSRNOG00000049063
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC16A9 pAb (ATL-HPA049286)
Datasheet Anti SLC16A9 pAb (ATL-HPA049286) Datasheet (External Link)
Vendor Page Anti SLC16A9 pAb (ATL-HPA049286) at Atlas Antibodies

Documents & Links for Anti SLC16A9 pAb (ATL-HPA049286)
Datasheet Anti SLC16A9 pAb (ATL-HPA049286) Datasheet (External Link)
Vendor Page Anti SLC16A9 pAb (ATL-HPA049286)