Anti SLC16A2 pAb (ATL-HPA072719)

Atlas Antibodies

Catalog No.:
ATL-HPA072719-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: solute carrier family 16, member 2 (thyroid hormone transporter)
Gene Name: SLC16A2
Alternative Gene Name: AHDS, DXS128, MCT7, MCT8, MRX22, XPCT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033965: 93%, ENSRNOG00000002832: 90%
Entrez Gene ID: 6567
Uniprot ID: P36021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
Gene Sequence LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
Gene ID - Mouse ENSMUSG00000033965
Gene ID - Rat ENSRNOG00000002832
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC16A2 pAb (ATL-HPA072719)
Datasheet Anti SLC16A2 pAb (ATL-HPA072719) Datasheet (External Link)
Vendor Page Anti SLC16A2 pAb (ATL-HPA072719) at Atlas Antibodies

Documents & Links for Anti SLC16A2 pAb (ATL-HPA072719)
Datasheet Anti SLC16A2 pAb (ATL-HPA072719) Datasheet (External Link)
Vendor Page Anti SLC16A2 pAb (ATL-HPA072719)
Citations for Anti SLC16A2 pAb (ATL-HPA072719) – 1 Found
Shrestha, Pawan; Whelchel, Amy E; Nicholas, Sarah E; Liang, Wentao; Ma, Jian-Xing; Karamichos, Dimitrios. Monocarboxylate Transporters: Role and Regulation in Corneal Diabetes. Analytical Cellular Pathology (Amsterdam). 2022( 36340268):6718566.  PubMed