Anti SLC14A1 pAb (ATL-HPA059570)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059570-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SLC14A1
Alternative Gene Name: HsT1341, JK, RACH1, RACH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059336: 74%, ENSRNOG00000016753: 74%
Entrez Gene ID: 6563
Uniprot ID: Q13336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQI |
| Gene Sequence | GHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQI |
| Gene ID - Mouse | ENSMUSG00000059336 |
| Gene ID - Rat | ENSRNOG00000016753 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC14A1 pAb (ATL-HPA059570) | |
| Datasheet | Anti SLC14A1 pAb (ATL-HPA059570) Datasheet (External Link) |
| Vendor Page | Anti SLC14A1 pAb (ATL-HPA059570) at Atlas Antibodies |
| Documents & Links for Anti SLC14A1 pAb (ATL-HPA059570) | |
| Datasheet | Anti SLC14A1 pAb (ATL-HPA059570) Datasheet (External Link) |
| Vendor Page | Anti SLC14A1 pAb (ATL-HPA059570) |