Anti SLC14A1 pAb (ATL-HPA059570)

Atlas Antibodies

Catalog No.:
ATL-HPA059570-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 14 (urea transporter), member 1 (Kidd blood group)
Gene Name: SLC14A1
Alternative Gene Name: HsT1341, JK, RACH1, RACH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059336: 74%, ENSRNOG00000016753: 74%
Entrez Gene ID: 6563
Uniprot ID: Q13336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQI
Gene Sequence GHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQI
Gene ID - Mouse ENSMUSG00000059336
Gene ID - Rat ENSRNOG00000016753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC14A1 pAb (ATL-HPA059570)
Datasheet Anti SLC14A1 pAb (ATL-HPA059570) Datasheet (External Link)
Vendor Page Anti SLC14A1 pAb (ATL-HPA059570) at Atlas Antibodies

Documents & Links for Anti SLC14A1 pAb (ATL-HPA059570)
Datasheet Anti SLC14A1 pAb (ATL-HPA059570) Datasheet (External Link)
Vendor Page Anti SLC14A1 pAb (ATL-HPA059570)