Anti SLC13A4 pAb (ATL-HPA048582)

Atlas Antibodies

Catalog No.: ATL-HPA048582-25

Protein Description: solute carrier family 13 (sodium/sulfate symporter), member 4
Gene Name: SLC13A4
Alternative Gene Name: SUT-1, SUT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029843: 71%, ENSRNOG00000011184: 73%
Entrez Gene ID: 26266
Uniprot ID: Q9UKG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLSLSI
• Gene Sequence: HNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLSLSI
• Gene ID - Mouse: ENSMUSG00000029843
• Gene ID - Rat: ENSRNOG00000011184
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.