Anti SLC12A5 pAb (ATL-HPA072058 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA072058-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-SLC12A5 antibody. Corresponding SLC12A5 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 12 (potassium/chloride transporter), member 5
Gene Name: SLC12A5
Alternative Gene Name: KCC2, KIAA1176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017740: 96%, ENSRNOG00000018111: 81%
Entrez Gene ID: 57468
Uniprot ID: Q9H2X9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSC
Gene Sequence ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSC
Gene ID - Mouse ENSMUSG00000017740
Gene ID - Rat ENSRNOG00000018111
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC12A5 pAb (ATL-HPA072058 w/enhanced validation)
Datasheet Anti SLC12A5 pAb (ATL-HPA072058 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC12A5 pAb (ATL-HPA072058 w/enhanced validation)