Anti SLC12A2 pAb (ATL-HPA063697)

Atlas Antibodies

Catalog No.:
ATL-HPA063697-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: solute carrier family 12 (sodium/potassium/chloride transporter), member 2
Gene Name: SLC12A2
Alternative Gene Name: BSC, BSC2, NKCC1, PPP1R141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024597: 97%, ENSRNOG00000015971: 98%
Entrez Gene ID: 6558
Uniprot ID: P55011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQAKYQRWLI
Gene Sequence QCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQAKYQRWLI
Gene ID - Mouse ENSMUSG00000024597
Gene ID - Rat ENSRNOG00000015971
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC12A2 pAb (ATL-HPA063697)
Datasheet Anti SLC12A2 pAb (ATL-HPA063697) Datasheet (External Link)
Vendor Page Anti SLC12A2 pAb (ATL-HPA063697) at Atlas Antibodies

Documents & Links for Anti SLC12A2 pAb (ATL-HPA063697)
Datasheet Anti SLC12A2 pAb (ATL-HPA063697) Datasheet (External Link)
Vendor Page Anti SLC12A2 pAb (ATL-HPA063697)