Anti SLC12A2 pAb (ATL-HPA063697)

Atlas Antibodies

Catalog No.: ATL-HPA063697-25

Protein Description: solute carrier family 12 (sodium/potassium/chloride transporter), member 2
Gene Name: SLC12A2
Alternative Gene Name: BSC, BSC2, NKCC1, PPP1R141
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024597: 97%, ENSRNOG00000015971: 98%
Entrez Gene ID: 6558
Uniprot ID: P55011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQAKYQRWLI
• Gene Sequence: QCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQAKYQRWLI
• Gene ID - Mouse: ENSMUSG00000024597
• Gene ID - Rat: ENSRNOG00000015971
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.