Anti SLC12A1 pAb (ATL-HPA018107 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018107-25

Protein Description: solute carrier family 12 (sodium/potassium/chloride transporter), member 1
Gene Name: SLC12A1
Alternative Gene Name: NKCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027202: 87%, ENSRNOG00000005367: 86%
Entrez Gene ID: 6557
Uniprot ID: Q13621
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQGFDISQVLQVQEELERLEQERLALEATIKDNECEEESGGIRGLFKKAGKLNITKTTPKKDGSINTSQSMHVGEFNQKLVEASTQFKKKQEKGTIDVWWLFDD
• Gene Sequence: SQGFDISQVLQVQEELERLEQERLALEATIKDNECEEESGGIRGLFKKAGKLNITKTTPKKDGSINTSQSMHVGEFNQKLVEASTQFKKKQEKGTIDVWWLFDD
• Gene ID - Mouse: ENSMUSG00000027202
• Gene ID - Rat: ENSRNOG00000005367
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC12A1 pAb (ATL-HPA018107 w/enhanced validation) – 3 Found

Lindström, Nils O; Tran, Tracy; Guo, Jinjin; Rutledge, Elisabeth; Parvez, Riana K; Thornton, Matthew E; Grubbs, Brendan; McMahon, Jill A; McMahon, Andrew P. Conserved and Divergent Molecular and Anatomic Features of Human and Mouse Nephron Patterning. Journal Of The American Society Of Nephrology : Jasn. 2018;29(3):825-840. 

Raimondo, Francesca; Chinello, Clizia; Porcaro, Luigi; Magni, Fulvio; Pitto, Marina. Urinary Extracellular Vesicles and Salt-Losing Tubulopathies: A Proteomic Approach. Proteomes. 2020;8(2) 

Sander, Veronika; Przepiorski, Aneta; Crunk, Amanda E; Hukriede, Neil A; Holm, Teresa M; Davidson, Alan J. Protocol for Large-Scale Production of Kidney Organoids from Human Pluripotent Stem Cells. Star Protocols. 2020;1(3):100150.