Anti SLC12A1 pAb (ATL-HPA014967 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014967-25

Protein Description: solute carrier family 12 (sodium/potassium/chloride transporter), member 1
Gene Name: SLC12A1
Alternative Gene Name: NKCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027202: 76%, ENSRNOG00000005367: 80%
Entrez Gene ID: 6557
Uniprot ID: Q13621
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSI
• Gene Sequence: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSI
• Gene ID - Mouse: ENSMUSG00000027202
• Gene ID - Rat: ENSRNOG00000005367
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC12A1 pAb (ATL-HPA014967 w/enhanced validation) – 2 Found

Frische, Sebastian; Chambrey, Régine; Trepiccione, Francesco; Zamani, Reza; Marcussen, Niels; Alexander, R Todd; Skjødt, Karsten; Svenningsen, Per; Dimke, Henrik. H(+)-ATPase B1 subunit localizes to thick ascending limb and distal convoluted tubule of rodent and human kidney. American Journal Of Physiology. Renal Physiology. 2018;315(3):F429-F444. 

Muto, Yoshiharu; Wilson, Parker C; Ledru, Nicolas; Wu, Haojia; Dimke, Henrik; Waikar, Sushrut S; Humphreys, Benjamin D. Single cell transcriptional and chromatin accessibility profiling redefine cellular heterogeneity in the adult human kidney. Nature Communications. 2021;12(1):2190.