Anti SLC10A7 pAb (ATL-HPA057906)

Atlas Antibodies

SKU:
ATL-HPA057906-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 10, member 7
Gene Name: SLC10A7
Alternative Gene Name: C4orf13, DKFZp313H0531, DKFZp566M114, DKFZp779O2438, MGC25043
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091318: 33%, ENSRNOG00000031855: 33%
Entrez Gene ID: 84068
Uniprot ID: Q0GE19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSWMVSRQKKLLQTRGPLANLNNPEGLEYLSIKFGH
Gene Sequence KSWMVSRQKKLLQTRGPLANLNNPEGLEYLSIKFGH
Gene ID - Mouse ENSMUSG00000091318
Gene ID - Rat ENSRNOG00000031855
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SLC10A7 pAb (ATL-HPA057906)
Datasheet Anti SLC10A7 pAb (ATL-HPA057906) Datasheet (External Link)
Vendor Page Anti SLC10A7 pAb (ATL-HPA057906) at Atlas Antibodies

Documents & Links for Anti SLC10A7 pAb (ATL-HPA057906)
Datasheet Anti SLC10A7 pAb (ATL-HPA057906) Datasheet (External Link)
Vendor Page Anti SLC10A7 pAb (ATL-HPA057906)