Anti SLC10A7 pAb (ATL-HPA057906)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057906-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SLC10A7
Alternative Gene Name: C4orf13, DKFZp313H0531, DKFZp566M114, DKFZp779O2438, MGC25043
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091318: 33%, ENSRNOG00000031855: 33%
Entrez Gene ID: 84068
Uniprot ID: Q0GE19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSWMVSRQKKLLQTRGPLANLNNPEGLEYLSIKFGH |
Gene Sequence | KSWMVSRQKKLLQTRGPLANLNNPEGLEYLSIKFGH |
Gene ID - Mouse | ENSMUSG00000091318 |
Gene ID - Rat | ENSRNOG00000031855 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC10A7 pAb (ATL-HPA057906) | |
Datasheet | Anti SLC10A7 pAb (ATL-HPA057906) Datasheet (External Link) |
Vendor Page | Anti SLC10A7 pAb (ATL-HPA057906) at Atlas Antibodies |
Documents & Links for Anti SLC10A7 pAb (ATL-HPA057906) | |
Datasheet | Anti SLC10A7 pAb (ATL-HPA057906) Datasheet (External Link) |
Vendor Page | Anti SLC10A7 pAb (ATL-HPA057906) |