Anti SLBP pAb (ATL-HPA061670 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA061670-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: stem-loop binding protein
Gene Name: SLBP
Alternative Gene Name: HBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004642: 88%, ENSRNOG00000037162: 88%
Entrez Gene ID: 7884
Uniprot ID: Q14493
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAM
Gene Sequence ESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAM
Gene ID - Mouse ENSMUSG00000004642
Gene ID - Rat ENSRNOG00000037162
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLBP pAb (ATL-HPA061670 w/enhanced validation)
Datasheet Anti SLBP pAb (ATL-HPA061670 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLBP pAb (ATL-HPA061670 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SLBP pAb (ATL-HPA061670 w/enhanced validation)
Datasheet Anti SLBP pAb (ATL-HPA061670 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLBP pAb (ATL-HPA061670 w/enhanced validation)