Anti SLBP pAb (ATL-HPA019254 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019254-25

Protein Description: stem-loop binding protein
Gene Name: SLBP
Alternative Gene Name: HBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004642: 91%, ENSRNOG00000037162: 89%
Entrez Gene ID: 7884
Uniprot ID: Q14493
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CDGDASFTTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTI
• Gene Sequence: CDGDASFTTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTI
• Gene ID - Mouse: ENSMUSG00000004642
• Gene ID - Rat: ENSRNOG00000037162
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLBP pAb (ATL-HPA019254 w/enhanced validation) – 1 Found

Wang, Yi-Chang; Kelso, Andrew A; Karamafrooz, Adak; Chen, Yi-Hsuan; Chen, Wei-Kai; Cheng, Chun-Ting; Qi, Yue; Gu, Long; Malkas, Linda; Kung, Hsing-Jien; Moldovan, George-Lucian; Ciccia, Alberto; Stark, Jeremy M; Ann, David K. Arginine shortage induces replication stress and confers genotoxic resistance by inhibiting histone H4 translation and promoting PCNA polyubiquitination. Biorxiv : The Preprint Server For Biology. 2023; 36778247( 36778247)