Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA067601-25
  • Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-SLAMF8 antibody. Corresponding SLAMF8 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SLAM family member 8
Gene Name: SLAMF8
Alternative Gene Name: BLAME, CD353, SBBI42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053318: 75%, ENSRNOG00000008736: 75%
Entrez Gene ID: 56833
Uniprot ID: Q9P0V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKD
Gene Sequence SEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKD
Gene ID - Mouse ENSMUSG00000053318
Gene ID - Rat ENSRNOG00000008736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation)
Datasheet Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation)