Anti SLAMF7 pAb (ATL-HPA061654)

Atlas Antibodies

SKU:
ATL-HPA061654-25
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SLAM family member 7
Gene Name: SLAMF7
Alternative Gene Name: 19A, CD319, CRACC, CS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038179: 49%, ENSRNOG00000023209: 43%
Entrez Gene ID: 57823
Uniprot ID: Q9NQ25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSL
Gene Sequence SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSL
Gene ID - Mouse ENSMUSG00000038179
Gene ID - Rat ENSRNOG00000023209
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SLAMF7 pAb (ATL-HPA061654)
Datasheet Anti SLAMF7 pAb (ATL-HPA061654) Datasheet (External Link)
Vendor Page Anti SLAMF7 pAb (ATL-HPA061654) at Atlas Antibodies

Documents & Links for Anti SLAMF7 pAb (ATL-HPA061654)
Datasheet Anti SLAMF7 pAb (ATL-HPA061654) Datasheet (External Link)
Vendor Page Anti SLAMF7 pAb (ATL-HPA061654)