Anti SLAMF6 pAb (ATL-HPA051363)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051363-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SLAMF6
Alternative Gene Name: CD352, KALI, KALIb, Ly108, NTB-A, NTBA, SF2000
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015314: 50%, ENSRNOG00000038286: 50%
Entrez Gene ID: 114836
Uniprot ID: Q96DU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKT |
| Gene Sequence | LPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKT |
| Gene ID - Mouse | ENSMUSG00000015314 |
| Gene ID - Rat | ENSRNOG00000038286 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLAMF6 pAb (ATL-HPA051363) | |
| Datasheet | Anti SLAMF6 pAb (ATL-HPA051363) Datasheet (External Link) |
| Vendor Page | Anti SLAMF6 pAb (ATL-HPA051363) at Atlas Antibodies |
| Documents & Links for Anti SLAMF6 pAb (ATL-HPA051363) | |
| Datasheet | Anti SLAMF6 pAb (ATL-HPA051363) Datasheet (External Link) |
| Vendor Page | Anti SLAMF6 pAb (ATL-HPA051363) |