Anti SKP1 pAb (ATL-HPA053745)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053745-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: SKP1
Alternative Gene Name: EMC19, MGC34403, OCP-II, OCP2, p19A, SKP1A, TCEB1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036309: 100%, ENSRNOG00000005828: 100%
Entrez Gene ID: 6500
Uniprot ID: P63208
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK |
Gene Sequence | KRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK |
Gene ID - Mouse | ENSMUSG00000036309 |
Gene ID - Rat | ENSRNOG00000005828 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SKP1 pAb (ATL-HPA053745) | |
Datasheet | Anti SKP1 pAb (ATL-HPA053745) Datasheet (External Link) |
Vendor Page | Anti SKP1 pAb (ATL-HPA053745) at Atlas Antibodies |
Documents & Links for Anti SKP1 pAb (ATL-HPA053745) | |
Datasheet | Anti SKP1 pAb (ATL-HPA053745) Datasheet (External Link) |
Vendor Page | Anti SKP1 pAb (ATL-HPA053745) |