Anti SKP1 pAb (ATL-HPA053745)

Atlas Antibodies

Catalog No.:
ATL-HPA053745-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: S-phase kinase-associated protein 1
Gene Name: SKP1
Alternative Gene Name: EMC19, MGC34403, OCP-II, OCP2, p19A, SKP1A, TCEB1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036309: 100%, ENSRNOG00000005828: 100%
Entrez Gene ID: 6500
Uniprot ID: P63208
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Gene Sequence KRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Gene ID - Mouse ENSMUSG00000036309
Gene ID - Rat ENSRNOG00000005828
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SKP1 pAb (ATL-HPA053745)
Datasheet Anti SKP1 pAb (ATL-HPA053745) Datasheet (External Link)
Vendor Page Anti SKP1 pAb (ATL-HPA053745) at Atlas Antibodies

Documents & Links for Anti SKP1 pAb (ATL-HPA053745)
Datasheet Anti SKP1 pAb (ATL-HPA053745) Datasheet (External Link)
Vendor Page Anti SKP1 pAb (ATL-HPA053745)