Anti SKOR1 pAb (ATL-HPA071150)

Atlas Antibodies

Catalog No.: ATL-HPA071150-25

Protein Description: SKI family transcriptional corepressor 1
Gene Name: SKOR1
Alternative Gene Name: CORL1, FUSSEL15, LBXCOR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022245: 79%, ENSRNOG00000013959: 78%
Entrez Gene ID: 390598
Uniprot ID: P84550
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPDGEQPTGPPSATSSGADGPANSPDGGSPRPRRRLGPPPAGRPAFGDLAAEDLVRRPERSPPSGGGGYELR
• Gene Sequence: GPDGEQPTGPPSATSSGADGPANSPDGGSPRPRRRLGPPPAGRPAFGDLAAEDLVRRPERSPPSGGGGYELR
• Gene ID - Mouse: ENSMUSG00000022245
• Gene ID - Rat: ENSRNOG00000013959
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.