Anti SKOR1 pAb (ATL-HPA071150)

Atlas Antibodies

Catalog No.:
ATL-HPA071150-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SKI family transcriptional corepressor 1
Gene Name: SKOR1
Alternative Gene Name: CORL1, FUSSEL15, LBXCOR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022245: 79%, ENSRNOG00000013959: 78%
Entrez Gene ID: 390598
Uniprot ID: P84550
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPDGEQPTGPPSATSSGADGPANSPDGGSPRPRRRLGPPPAGRPAFGDLAAEDLVRRPERSPPSGGGGYELR
Gene Sequence GPDGEQPTGPPSATSSGADGPANSPDGGSPRPRRRLGPPPAGRPAFGDLAAEDLVRRPERSPPSGGGGYELR
Gene ID - Mouse ENSMUSG00000022245
Gene ID - Rat ENSRNOG00000013959
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SKOR1 pAb (ATL-HPA071150)
Datasheet Anti SKOR1 pAb (ATL-HPA071150) Datasheet (External Link)
Vendor Page Anti SKOR1 pAb (ATL-HPA071150) at Atlas Antibodies

Documents & Links for Anti SKOR1 pAb (ATL-HPA071150)
Datasheet Anti SKOR1 pAb (ATL-HPA071150) Datasheet (External Link)
Vendor Page Anti SKOR1 pAb (ATL-HPA071150)