Anti SKAP1 pAb (ATL-HPA002969 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002969-25

Protein Description: src kinase associated phosphoprotein 1
Gene Name: SKAP1
Alternative Gene Name: SCAP1, SKAP55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057058: 69%, ENSRNOG00000023881: 67%
Entrez Gene ID: 8631
Uniprot ID: Q86WV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDL
• Gene Sequence: SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDL
• Gene ID - Mouse: ENSMUSG00000057058
• Gene ID - Rat: ENSRNOG00000023881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SKAP1 pAb (ATL-HPA002969 w/enhanced validation) – 1 Found

van Doorn, Remco; van Kester, Marloes S; Dijkman, Remco; Vermeer, Maarten H; Mulder, Aat A; Szuhai, Karoly; Knijnenburg, Jeroen; Boer, Judith M; Willemze, Rein; Tensen, Cornelis P. Oncogenomic analysis of mycosis fungoides reveals major differences with Sezary syndrome. Blood. 2009;113(1):127-36.