Anti SKA2 pAb (ATL-HPA059235)

Atlas Antibodies

SKU: ATL-HPA059235-25

• 

Protein Description: spindle and kinetochore associated complex subunit 2
Gene Name: SKA2
Alternative Gene Name: FAM33A, FLJ12758
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020492: 85%, ENSRNOG00000025981: 81%
Entrez Gene ID: 348235
Uniprot ID: Q8WVK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS
• Gene Sequence: EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS
• Gene ID - Mouse: ENSMUSG00000020492
• Gene ID - Rat: ENSRNOG00000025981
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.