Anti SKA2 pAb (ATL-HPA059235)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059235-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SKA2
Alternative Gene Name: FAM33A, FLJ12758
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020492: 85%, ENSRNOG00000025981: 81%
Entrez Gene ID: 348235
Uniprot ID: Q8WVK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS |
| Gene Sequence | EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS |
| Gene ID - Mouse | ENSMUSG00000020492 |
| Gene ID - Rat | ENSRNOG00000025981 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SKA2 pAb (ATL-HPA059235) | |
| Datasheet | Anti SKA2 pAb (ATL-HPA059235) Datasheet (External Link) |
| Vendor Page | Anti SKA2 pAb (ATL-HPA059235) at Atlas Antibodies |
| Documents & Links for Anti SKA2 pAb (ATL-HPA059235) | |
| Datasheet | Anti SKA2 pAb (ATL-HPA059235) Datasheet (External Link) |
| Vendor Page | Anti SKA2 pAb (ATL-HPA059235) |