Anti SKA2 pAb (ATL-HPA059235)

Atlas Antibodies

Catalog No.:
ATL-HPA059235-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: spindle and kinetochore associated complex subunit 2
Gene Name: SKA2
Alternative Gene Name: FAM33A, FLJ12758
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020492: 85%, ENSRNOG00000025981: 81%
Entrez Gene ID: 348235
Uniprot ID: Q8WVK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS
Gene Sequence EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS
Gene ID - Mouse ENSMUSG00000020492
Gene ID - Rat ENSRNOG00000025981
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SKA2 pAb (ATL-HPA059235)
Datasheet Anti SKA2 pAb (ATL-HPA059235) Datasheet (External Link)
Vendor Page Anti SKA2 pAb (ATL-HPA059235) at Atlas Antibodies

Documents & Links for Anti SKA2 pAb (ATL-HPA059235)
Datasheet Anti SKA2 pAb (ATL-HPA059235) Datasheet (External Link)
Vendor Page Anti SKA2 pAb (ATL-HPA059235)