Anti SIX5 pAb (ATL-HPA042068)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042068-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SIX5
Alternative Gene Name: DMAHP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040841: 97%, ENSRNOG00000060146: 90%
Entrez Gene ID: 147912
Uniprot ID: Q8N196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVPTSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFLLANPVSGSPIVTGVAVQQGKIILTATFPTSMLVSQVLP |
| Gene Sequence | VVPTSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFLLANPVSGSPIVTGVAVQQGKIILTATFPTSMLVSQVLP |
| Gene ID - Mouse | ENSMUSG00000040841 |
| Gene ID - Rat | ENSRNOG00000060146 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIX5 pAb (ATL-HPA042068) | |
| Datasheet | Anti SIX5 pAb (ATL-HPA042068) Datasheet (External Link) |
| Vendor Page | Anti SIX5 pAb (ATL-HPA042068) at Atlas Antibodies |
| Documents & Links for Anti SIX5 pAb (ATL-HPA042068) | |
| Datasheet | Anti SIX5 pAb (ATL-HPA042068) Datasheet (External Link) |
| Vendor Page | Anti SIX5 pAb (ATL-HPA042068) |