Anti SIX3 pAb (ATL-HPA067988)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067988-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SIX3
Alternative Gene Name: HPE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038805: 100%, ENSRNOG00000057031: 100%
Entrez Gene ID: 6496
Uniprot ID: O95343
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDS |
| Gene Sequence | KNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDS |
| Gene ID - Mouse | ENSMUSG00000038805 |
| Gene ID - Rat | ENSRNOG00000057031 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIX3 pAb (ATL-HPA067988) | |
| Datasheet | Anti SIX3 pAb (ATL-HPA067988) Datasheet (External Link) |
| Vendor Page | Anti SIX3 pAb (ATL-HPA067988) at Atlas Antibodies |
| Documents & Links for Anti SIX3 pAb (ATL-HPA067988) | |
| Datasheet | Anti SIX3 pAb (ATL-HPA067988) Datasheet (External Link) |
| Vendor Page | Anti SIX3 pAb (ATL-HPA067988) |