Anti SIX3 pAb (ATL-HPA067988)

Atlas Antibodies

Catalog No.:
ATL-HPA067988-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: SIX homeobox 3
Gene Name: SIX3
Alternative Gene Name: HPE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038805: 100%, ENSRNOG00000057031: 100%
Entrez Gene ID: 6496
Uniprot ID: O95343
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDS
Gene Sequence KNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDS
Gene ID - Mouse ENSMUSG00000038805
Gene ID - Rat ENSRNOG00000057031
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIX3 pAb (ATL-HPA067988)
Datasheet Anti SIX3 pAb (ATL-HPA067988) Datasheet (External Link)
Vendor Page Anti SIX3 pAb (ATL-HPA067988) at Atlas Antibodies

Documents & Links for Anti SIX3 pAb (ATL-HPA067988)
Datasheet Anti SIX3 pAb (ATL-HPA067988) Datasheet (External Link)
Vendor Page Anti SIX3 pAb (ATL-HPA067988)