Anti SIVA1 pAb (ATL-HPA066693)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066693-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SIVA1
Alternative Gene Name: CD27BP, SIVA, Siva-1, Siva-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064326: 68%, ENSRNOG00000028640: 74%
Entrez Gene ID: 10572
Uniprot ID: O15304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACT |
| Gene Sequence | IRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACT |
| Gene ID - Mouse | ENSMUSG00000064326 |
| Gene ID - Rat | ENSRNOG00000028640 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIVA1 pAb (ATL-HPA066693) | |
| Datasheet | Anti SIVA1 pAb (ATL-HPA066693) Datasheet (External Link) |
| Vendor Page | Anti SIVA1 pAb (ATL-HPA066693) at Atlas Antibodies |
| Documents & Links for Anti SIVA1 pAb (ATL-HPA066693) | |
| Datasheet | Anti SIVA1 pAb (ATL-HPA066693) Datasheet (External Link) |
| Vendor Page | Anti SIVA1 pAb (ATL-HPA066693) |