Anti SIVA1 pAb (ATL-HPA066693)

Atlas Antibodies

Catalog No.:
ATL-HPA066693-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SIVA1, apoptosis-inducing factor
Gene Name: SIVA1
Alternative Gene Name: CD27BP, SIVA, Siva-1, Siva-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064326: 68%, ENSRNOG00000028640: 74%
Entrez Gene ID: 10572
Uniprot ID: O15304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACT
Gene Sequence IRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACT
Gene ID - Mouse ENSMUSG00000064326
Gene ID - Rat ENSRNOG00000028640
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIVA1 pAb (ATL-HPA066693)
Datasheet Anti SIVA1 pAb (ATL-HPA066693) Datasheet (External Link)
Vendor Page Anti SIVA1 pAb (ATL-HPA066693) at Atlas Antibodies

Documents & Links for Anti SIVA1 pAb (ATL-HPA066693)
Datasheet Anti SIVA1 pAb (ATL-HPA066693) Datasheet (External Link)
Vendor Page Anti SIVA1 pAb (ATL-HPA066693)