Anti SIRT7 pAb (ATL-HPA027284)

Atlas Antibodies

Catalog No.:
ATL-HPA027284-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: sirtuin 7
Gene Name: SIRT7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025138: 99%, ENSRNOG00000036683: 95%
Entrez Gene ID: 51547
Uniprot ID: Q9NRC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADLSEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISE
Gene Sequence LVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADLSEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISE
Gene ID - Mouse ENSMUSG00000025138
Gene ID - Rat ENSRNOG00000036683
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIRT7 pAb (ATL-HPA027284)
Datasheet Anti SIRT7 pAb (ATL-HPA027284) Datasheet (External Link)
Vendor Page Anti SIRT7 pAb (ATL-HPA027284) at Atlas Antibodies

Documents & Links for Anti SIRT7 pAb (ATL-HPA027284)
Datasheet Anti SIRT7 pAb (ATL-HPA027284) Datasheet (External Link)
Vendor Page Anti SIRT7 pAb (ATL-HPA027284)