Anti SIRT7 pAb (ATL-HPA027284)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027284-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SIRT7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025138: 99%, ENSRNOG00000036683: 95%
Entrez Gene ID: 51547
Uniprot ID: Q9NRC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADLSEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISE |
| Gene Sequence | LVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADLSEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISE |
| Gene ID - Mouse | ENSMUSG00000025138 |
| Gene ID - Rat | ENSRNOG00000036683 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIRT7 pAb (ATL-HPA027284) | |
| Datasheet | Anti SIRT7 pAb (ATL-HPA027284) Datasheet (External Link) |
| Vendor Page | Anti SIRT7 pAb (ATL-HPA027284) at Atlas Antibodies |
| Documents & Links for Anti SIRT7 pAb (ATL-HPA027284) | |
| Datasheet | Anti SIRT7 pAb (ATL-HPA027284) Datasheet (External Link) |
| Vendor Page | Anti SIRT7 pAb (ATL-HPA027284) |