Anti SIRT6 pAb (ATL-HPA049729)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049729-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: SIRT6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034748: 93%, ENSRNOG00000006393: 91%
Entrez Gene ID: 51548
Uniprot ID: Q8N6T7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHL |
Gene Sequence | DRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHL |
Gene ID - Mouse | ENSMUSG00000034748 |
Gene ID - Rat | ENSRNOG00000006393 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SIRT6 pAb (ATL-HPA049729) | |
Datasheet | Anti SIRT6 pAb (ATL-HPA049729) Datasheet (External Link) |
Vendor Page | Anti SIRT6 pAb (ATL-HPA049729) at Atlas Antibodies |
Documents & Links for Anti SIRT6 pAb (ATL-HPA049729) | |
Datasheet | Anti SIRT6 pAb (ATL-HPA049729) Datasheet (External Link) |
Vendor Page | Anti SIRT6 pAb (ATL-HPA049729) |