Anti SIRT6 pAb (ATL-HPA049729)

Atlas Antibodies

Catalog No.:
ATL-HPA049729-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: sirtuin 6
Gene Name: SIRT6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034748: 93%, ENSRNOG00000006393: 91%
Entrez Gene ID: 51548
Uniprot ID: Q8N6T7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHL
Gene Sequence DRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHL
Gene ID - Mouse ENSMUSG00000034748
Gene ID - Rat ENSRNOG00000006393
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIRT6 pAb (ATL-HPA049729)
Datasheet Anti SIRT6 pAb (ATL-HPA049729) Datasheet (External Link)
Vendor Page Anti SIRT6 pAb (ATL-HPA049729) at Atlas Antibodies

Documents & Links for Anti SIRT6 pAb (ATL-HPA049729)
Datasheet Anti SIRT6 pAb (ATL-HPA049729) Datasheet (External Link)
Vendor Page Anti SIRT6 pAb (ATL-HPA049729)