Anti SIRT5 pAb (ATL-HPA022992)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022992-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SIRT5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054021: 87%, ENSRNOG00000017866: 87%
Entrez Gene ID: 23408
Uniprot ID: Q9NXA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQN |
| Gene Sequence | AKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQN |
| Gene ID - Mouse | ENSMUSG00000054021 |
| Gene ID - Rat | ENSRNOG00000017866 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIRT5 pAb (ATL-HPA022992) | |
| Datasheet | Anti SIRT5 pAb (ATL-HPA022992) Datasheet (External Link) |
| Vendor Page | Anti SIRT5 pAb (ATL-HPA022992) at Atlas Antibodies |
| Documents & Links for Anti SIRT5 pAb (ATL-HPA022992) | |
| Datasheet | Anti SIRT5 pAb (ATL-HPA022992) Datasheet (External Link) |
| Vendor Page | Anti SIRT5 pAb (ATL-HPA022992) |
| Citations for Anti SIRT5 pAb (ATL-HPA022992) – 1 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |