Anti SIRT5 pAb (ATL-HPA022992)

Atlas Antibodies

Catalog No.: ATL-HPA022992-25

Protein Description: sirtuin 5
Gene Name: SIRT5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054021: 87%, ENSRNOG00000017866: 87%
Entrez Gene ID: 23408
Uniprot ID: Q9NXA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQN
• Gene Sequence: AKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQN
• Gene ID - Mouse: ENSMUSG00000054021
• Gene ID - Rat: ENSRNOG00000017866
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SIRT5 pAb (ATL-HPA022992) – 1 Found

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.