Anti SIRT1 pAb (ATL-HPA006295)

Atlas Antibodies

Catalog No.:
ATL-HPA006295-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: sirtuin 1
Gene Name: SIRT1
Alternative Gene Name: SIR2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020063: 80%, ENSRNOG00000051592: 80%
Entrez Gene ID: 23411
Uniprot ID: Q96EB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD
Gene Sequence IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD
Gene ID - Mouse ENSMUSG00000020063
Gene ID - Rat ENSRNOG00000051592
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIRT1 pAb (ATL-HPA006295)
Datasheet Anti SIRT1 pAb (ATL-HPA006295) Datasheet (External Link)
Vendor Page Anti SIRT1 pAb (ATL-HPA006295) at Atlas Antibodies

Documents & Links for Anti SIRT1 pAb (ATL-HPA006295)
Datasheet Anti SIRT1 pAb (ATL-HPA006295) Datasheet (External Link)
Vendor Page Anti SIRT1 pAb (ATL-HPA006295)
Citations for Anti SIRT1 pAb (ATL-HPA006295) – 7 Found
Theendakara, Veena; Peters-Libeu, Clare A; Spilman, Patricia; Poksay, Karen S; Bredesen, Dale E; Rao, Rammohan V. Direct Transcriptional Effects of Apolipoprotein E. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2016;36(3):685-700.  PubMed
Brandl, Lydia; Zhang, Yina; Kirstein, Nina; Sendelhofert, Andrea; Boos, Sophie Luise; Jung, Peter; Greten, Florian; Rad, Roland; Menssen, Antje. Targeting c-MYC through Interference with NAMPT and SIRT1 and Their Association to Oncogenic Drivers in Murine Serrated Intestinal Tumorigenesis. Neoplasia (New York, N.y.). 2019;21(10):974-988.  PubMed
Noguchi, Akira; Kikuchi, Keiji; Zheng, Huachuan; Takahashi, Hiroyuki; Miyagi, Yohei; Aoki, Ichiro; Takano, Yasuo. SIRT1 expression is associated with a poor prognosis, whereas DBC1 is associated with favorable outcomes in gastric cancer. Cancer Medicine. 2014;3(6):1553-61.  PubMed
Pinho, Andreia V; Bensellam, Mohammed; Wauters, Elke; Rees, Maxine; Giry-Laterriere, Marc; Mawson, Amanda; Ly, Le Quan; Biankin, Andrew V; Wu, Jianmin; Laybutt, D Ross; Rooman, Ilse. Pancreas-Specific Sirt1-Deficiency in Mice Compromises Beta-Cell Function without Development of Hyperglycemia. Plos One. 10(6):e0128012.  PubMed
Beyer, Susanne; Chen, Fangfang; Meister, Sarah; Czogalla, Bastian; Kolben, Theresa M; Hester, Anna; Burges, Alexander; Trillsch, Fabian; Schmöckel, Elisa; Mayr, Doris; Mayerhofer, Artur; Mahner, Sven; Jeschke, Udo; Kolben, Thomas. Sirtuin1 expression and survival in endometrial and clear-cell uterine cancer. Histochemistry And Cell Biology. 2020;154(2):189-195.  PubMed
Schmid, Nina; Dietrich, Kim-Gwendolyn; Forne, Ignasi; Burges, Alexander; Szymanska, Magdalena; Meidan, Rina; Mayr, Doris; Mayerhofer, Artur. Sirtuin 1 and Sirtuin 3 in Granulosa Cell Tumors. International Journal Of Molecular Sciences. 2021;22(4)  PubMed
Wahab, Fazal; Rodriguez Polo, Ignacio; Behr, Rüdiger. SIRT1 Expression and Regulation in the Primate Testis. International Journal Of Molecular Sciences. 2021;22(6)  PubMed