Anti SIPA1L2 pAb (ATL-HPA024181)

Atlas Antibodies

Catalog No.:
ATL-HPA024181-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: signal-induced proliferation-associated 1 like 2
Gene Name: SIPA1L2
Alternative Gene Name: KIAA1389
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001995: 83%, ENSRNOG00000019791: 82%
Entrez Gene ID: 57568
Uniprot ID: Q9P2F8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQVPGSMSKPYHRQGAVNKYVIGWKKSEGSPPPEEPEVTECPGMYSEMDVMSTATQHQTVVGDAVAETQHVLSKEDFLKLMLPD
Gene Sequence QQVPGSMSKPYHRQGAVNKYVIGWKKSEGSPPPEEPEVTECPGMYSEMDVMSTATQHQTVVGDAVAETQHVLSKEDFLKLMLPD
Gene ID - Mouse ENSMUSG00000001995
Gene ID - Rat ENSRNOG00000019791
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIPA1L2 pAb (ATL-HPA024181)
Datasheet Anti SIPA1L2 pAb (ATL-HPA024181) Datasheet (External Link)
Vendor Page Anti SIPA1L2 pAb (ATL-HPA024181) at Atlas Antibodies

Documents & Links for Anti SIPA1L2 pAb (ATL-HPA024181)
Datasheet Anti SIPA1L2 pAb (ATL-HPA024181) Datasheet (External Link)
Vendor Page Anti SIPA1L2 pAb (ATL-HPA024181)