Anti SIN3B pAb (ATL-HPA050329)

Atlas Antibodies

SKU:
ATL-HPA050329-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SIN3 transcription regulator family member B
Gene Name: SIN3B
Alternative Gene Name: KIAA0700
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031622: 51%, ENSRNOG00000032254: 36%
Entrez Gene ID: 23309
Uniprot ID: O75182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDRDSPQGQTTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPP
Gene Sequence LISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDRDSPQGQTTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPP
Gene ID - Mouse ENSMUSG00000031622
Gene ID - Rat ENSRNOG00000032254
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SIN3B pAb (ATL-HPA050329)
Datasheet Anti SIN3B pAb (ATL-HPA050329) Datasheet (External Link)
Vendor Page Anti SIN3B pAb (ATL-HPA050329) at Atlas Antibodies

Documents & Links for Anti SIN3B pAb (ATL-HPA050329)
Datasheet Anti SIN3B pAb (ATL-HPA050329) Datasheet (External Link)
Vendor Page Anti SIN3B pAb (ATL-HPA050329)