Anti SIMC1 pAb (ATL-HPA037890)

Atlas Antibodies

Catalog No.:
ATL-HPA037890-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SUMO-interacting motifs containing 1
Gene Name: SIMC1
Alternative Gene Name: C5orf25, FLJ44216, OOMA1, PLEIAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043183: 77%, ENSRNOG00000016932: 72%
Entrez Gene ID: 375484
Uniprot ID: Q8NDZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVIDLTRAEGENRPIATLDLTLEPVTPSQREPTSLQTCASLSGKAVMEGQVDRSSQPTARRLINSDPVDLDLVEE
Gene Sequence YVIDLTRAEGENRPIATLDLTLEPVTPSQREPTSLQTCASLSGKAVMEGQVDRSSQPTARRLINSDPVDLDLVEE
Gene ID - Mouse ENSMUSG00000043183
Gene ID - Rat ENSRNOG00000016932
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIMC1 pAb (ATL-HPA037890)
Datasheet Anti SIMC1 pAb (ATL-HPA037890) Datasheet (External Link)
Vendor Page Anti SIMC1 pAb (ATL-HPA037890) at Atlas Antibodies

Documents & Links for Anti SIMC1 pAb (ATL-HPA037890)
Datasheet Anti SIMC1 pAb (ATL-HPA037890) Datasheet (External Link)
Vendor Page Anti SIMC1 pAb (ATL-HPA037890)