Anti SIMC1 pAb (ATL-HPA037889)

Atlas Antibodies

Catalog No.: ATL-HPA037889-25

Protein Description: SUMO-interacting motifs containing 1
Gene Name: SIMC1
Alternative Gene Name: C5orf25, FLJ44216, OOMA1, PLEIAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043183: 98%, ENSRNOG00000016932: 98%
Entrez Gene ID: 375484
Uniprot ID: Q8NDZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKIQQLHPANAKTVEWDWKLLTYVMEEEGQTLPGRVLFLRYVVQTLEDDFQQTLRRQRQHLQQSIANMVLSCDKQPHNVRDVIKWLVKA
• Gene Sequence: MKIQQLHPANAKTVEWDWKLLTYVMEEEGQTLPGRVLFLRYVVQTLEDDFQQTLRRQRQHLQQSIANMVLSCDKQPHNVRDVIKWLVKA
• Gene ID - Mouse: ENSMUSG00000043183
• Gene ID - Rat: ENSRNOG00000016932
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.