Anti SIK2 pAb (ATL-HPA071049)

Atlas Antibodies

Catalog No.:
ATL-HPA071049-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: salt inducible kinase 2
Gene Name: SIK2
Alternative Gene Name: DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037112: 89%, ENSRNOG00000043498: 89%
Entrez Gene ID: 23235
Uniprot ID: Q9H0K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQI
Gene Sequence VHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQI
Gene ID - Mouse ENSMUSG00000037112
Gene ID - Rat ENSRNOG00000043498
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIK2 pAb (ATL-HPA071049)
Datasheet Anti SIK2 pAb (ATL-HPA071049) Datasheet (External Link)
Vendor Page Anti SIK2 pAb (ATL-HPA071049) at Atlas Antibodies

Documents & Links for Anti SIK2 pAb (ATL-HPA071049)
Datasheet Anti SIK2 pAb (ATL-HPA071049) Datasheet (External Link)
Vendor Page Anti SIK2 pAb (ATL-HPA071049)