Anti SIK2 pAb (ATL-HPA071049)

Atlas Antibodies

SKU: ATL-HPA071049-25

• 

Protein Description: salt inducible kinase 2
Gene Name: SIK2
Alternative Gene Name: DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037112: 89%, ENSRNOG00000043498: 89%
Entrez Gene ID: 23235
Uniprot ID: Q9H0K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQI
• Gene Sequence: VHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQI
• Gene ID - Mouse: ENSMUSG00000037112
• Gene ID - Rat: ENSRNOG00000043498
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.