Anti SIGLEC6 pAb (ATL-HPA009084 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA009084-25

Protein Description: sialic acid binding Ig-like lectin 6
Gene Name: SIGLEC6
Alternative Gene Name: CD327, CD33L, CD33L1, OB-BP1, SIGLEC-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030474: 35%, ENSRNOG00000022640: 32%
Entrez Gene ID: 946
Uniprot ID: O43699
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
• Gene Sequence: RVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
• Gene ID - Mouse: ENSMUSG00000030474
• Gene ID - Rat: ENSRNOG00000022640
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SIGLEC6 pAb (ATL-HPA009084 w/enhanced validation) – 1 Found

Yu, Yingxin; Blokhuis, Bart R J; Diks, Mara A P; Keshavarzian, Ali; Garssen, Johan; Redegeld, Frank A. Functional Inhibitory Siglec-6 Is Upregulated in Human Colorectal Cancer-Associated Mast Cells. Frontiers In Immunology. 9( 30294327):2138.