Anti SIGLEC6 pAb (ATL-HPA009084 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA009084-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SIGLEC6
Alternative Gene Name: CD327, CD33L, CD33L1, OB-BP1, SIGLEC-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030474: 35%, ENSRNOG00000022640: 32%
Entrez Gene ID: 946
Uniprot ID: O43699
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK |
| Gene Sequence | RVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK |
| Gene ID - Mouse | ENSMUSG00000030474 |
| Gene ID - Rat | ENSRNOG00000022640 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIGLEC6 pAb (ATL-HPA009084 w/enhanced validation) | |
| Datasheet | Anti SIGLEC6 pAb (ATL-HPA009084 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SIGLEC6 pAb (ATL-HPA009084 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SIGLEC6 pAb (ATL-HPA009084 w/enhanced validation) | |
| Datasheet | Anti SIGLEC6 pAb (ATL-HPA009084 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SIGLEC6 pAb (ATL-HPA009084 w/enhanced validation) |
| Citations for Anti SIGLEC6 pAb (ATL-HPA009084 w/enhanced validation) – 1 Found |
| Yu, Yingxin; Blokhuis, Bart R J; Diks, Mara A P; Keshavarzian, Ali; Garssen, Johan; Redegeld, Frank A. Functional Inhibitory Siglec-6 Is Upregulated in Human Colorectal Cancer-Associated Mast Cells. Frontiers In Immunology. 9( 30294327):2138. PubMed |