Anti SIGLEC14 pAb (ATL-HPA014377)

Atlas Antibodies

Catalog No.:
ATL-HPA014377-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sialic acid binding Ig-like lectin 14
Gene Name: SIGLEC14
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030474: 50%, ENSRNOG00000022640: 47%
Entrez Gene ID: 100049587
Uniprot ID: Q08ET2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CQVKRQGAQVTTERTVQLNVSYAPQNLAISIFFRNGTGTALRILSNGMSVPIQEGQSLFLACTVDSNPPASLSWFREGKALNPSQTSMSGTLELPNIGAREGGEFTCRVQHPLGSQHLSF
Gene Sequence CQVKRQGAQVTTERTVQLNVSYAPQNLAISIFFRNGTGTALRILSNGMSVPIQEGQSLFLACTVDSNPPASLSWFREGKALNPSQTSMSGTLELPNIGAREGGEFTCRVQHPLGSQHLSF
Gene ID - Mouse ENSMUSG00000030474
Gene ID - Rat ENSRNOG00000022640
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIGLEC14 pAb (ATL-HPA014377)
Datasheet Anti SIGLEC14 pAb (ATL-HPA014377) Datasheet (External Link)
Vendor Page Anti SIGLEC14 pAb (ATL-HPA014377) at Atlas Antibodies

Documents & Links for Anti SIGLEC14 pAb (ATL-HPA014377)
Datasheet Anti SIGLEC14 pAb (ATL-HPA014377) Datasheet (External Link)
Vendor Page Anti SIGLEC14 pAb (ATL-HPA014377)