Anti SIGLEC11 pAb (ATL-HPA060278)

Atlas Antibodies

Catalog No.:
ATL-HPA060278-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sialic acid binding Ig-like lectin 11
Gene Name: SIGLEC11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028599: 37%, ENSRNOG00000011619: 35%
Entrez Gene ID: 114132
Uniprot ID: Q96RL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSEIKIHTGQPLRGPGFGLQLEREMSGMVPK
Gene Sequence YSEIKIHTGQPLRGPGFGLQLEREMSGMVPK
Gene ID - Mouse ENSMUSG00000028599
Gene ID - Rat ENSRNOG00000011619
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIGLEC11 pAb (ATL-HPA060278)
Datasheet Anti SIGLEC11 pAb (ATL-HPA060278) Datasheet (External Link)
Vendor Page Anti SIGLEC11 pAb (ATL-HPA060278) at Atlas Antibodies

Documents & Links for Anti SIGLEC11 pAb (ATL-HPA060278)
Datasheet Anti SIGLEC11 pAb (ATL-HPA060278) Datasheet (External Link)
Vendor Page Anti SIGLEC11 pAb (ATL-HPA060278)