Anti SIGLEC1 pAb (ATL-HPA053457)

Atlas Antibodies

Catalog No.:
ATL-HPA053457-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: sialic acid binding Ig-like lectin 1, sialoadhesin
Gene Name: SIGLEC1
Alternative Gene Name: CD169, dJ1009E24.1, FLJ00051, FLJ00055, FLJ00073, FLJ32150, sialoadhesin, SIGLEC-1, SN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027322: 72%, ENSRNOG00000021243: 68%
Entrez Gene ID: 6614
Uniprot ID: Q9BZZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH
Gene Sequence CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH
Gene ID - Mouse ENSMUSG00000027322
Gene ID - Rat ENSRNOG00000021243
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIGLEC1 pAb (ATL-HPA053457)
Datasheet Anti SIGLEC1 pAb (ATL-HPA053457) Datasheet (External Link)
Vendor Page Anti SIGLEC1 pAb (ATL-HPA053457) at Atlas Antibodies

Documents & Links for Anti SIGLEC1 pAb (ATL-HPA053457)
Datasheet Anti SIGLEC1 pAb (ATL-HPA053457) Datasheet (External Link)
Vendor Page Anti SIGLEC1 pAb (ATL-HPA053457)
Citations for Anti SIGLEC1 pAb (ATL-HPA053457) – 2 Found
Kidder, Dana; Bray, Susan E; Fleming, Stewart. Differences in the frequency of macrophage and T cell markers between focal and crescentic classes of anti-neutrophil cytoplasmic antibody (ANCA)-associated glomerulonephritis. Journal Of Nephropathology. 2017;6(2):97-102.  PubMed
Clancy, Robert M; Halushka, Marc; Rasmussen, Sara E; Lhakhang, Tenzin; Chang, Miao; Buyon, Jill P. Siglec-1 Macrophages and the Contribution of IFN to the Development of Autoimmune Congenital Heart Block. Journal Of Immunology (Baltimore, Md. : 1950). 2019;202(1):48-55.  PubMed