Anti SIGLEC1 pAb (ATL-HPA053457)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053457-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SIGLEC1
Alternative Gene Name: CD169, dJ1009E24.1, FLJ00051, FLJ00055, FLJ00073, FLJ32150, sialoadhesin, SIGLEC-1, SN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027322: 72%, ENSRNOG00000021243: 68%
Entrez Gene ID: 6614
Uniprot ID: Q9BZZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH |
| Gene Sequence | CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH |
| Gene ID - Mouse | ENSMUSG00000027322 |
| Gene ID - Rat | ENSRNOG00000021243 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIGLEC1 pAb (ATL-HPA053457) | |
| Datasheet | Anti SIGLEC1 pAb (ATL-HPA053457) Datasheet (External Link) |
| Vendor Page | Anti SIGLEC1 pAb (ATL-HPA053457) at Atlas Antibodies |
| Documents & Links for Anti SIGLEC1 pAb (ATL-HPA053457) | |
| Datasheet | Anti SIGLEC1 pAb (ATL-HPA053457) Datasheet (External Link) |
| Vendor Page | Anti SIGLEC1 pAb (ATL-HPA053457) |
| Citations for Anti SIGLEC1 pAb (ATL-HPA053457) – 2 Found |
| Kidder, Dana; Bray, Susan E; Fleming, Stewart. Differences in the frequency of macrophage and T cell markers between focal and crescentic classes of anti-neutrophil cytoplasmic antibody (ANCA)-associated glomerulonephritis. Journal Of Nephropathology. 2017;6(2):97-102. PubMed |
| Clancy, Robert M; Halushka, Marc; Rasmussen, Sara E; Lhakhang, Tenzin; Chang, Miao; Buyon, Jill P. Siglec-1 Macrophages and the Contribution of IFN to the Development of Autoimmune Congenital Heart Block. Journal Of Immunology (Baltimore, Md. : 1950). 2019;202(1):48-55. PubMed |