Anti SIAH3 pAb (ATL-HPA060576)

Atlas Antibodies

SKU:
ATL-HPA060576-25
  • Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: siah E3 ubiquitin protein ligase family member 3
Gene Name: SIAH3
Alternative Gene Name: FLJ39203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091722: 84%, ENSRNOG00000043061: 81%
Entrez Gene ID: 283514
Uniprot ID: Q8IW03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRLEVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHS
Gene Sequence SFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRLEVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHS
Gene ID - Mouse ENSMUSG00000091722
Gene ID - Rat ENSRNOG00000043061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SIAH3 pAb (ATL-HPA060576)
Datasheet Anti SIAH3 pAb (ATL-HPA060576) Datasheet (External Link)
Vendor Page Anti SIAH3 pAb (ATL-HPA060576) at Atlas Antibodies

Documents & Links for Anti SIAH3 pAb (ATL-HPA060576)
Datasheet Anti SIAH3 pAb (ATL-HPA060576) Datasheet (External Link)
Vendor Page Anti SIAH3 pAb (ATL-HPA060576)