Anti SHTN1 pAb (ATL-HPA037943 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037943-25

Protein Description: shootin 1
Gene Name: SHTN1
Alternative Gene Name: KIAA1598, shootin-1, shootin1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041362: 100%, ENSRNOG00000018350: 98%
Entrez Gene ID: 57698
Uniprot ID: A0MZ66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKEKCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQNHLEIEKTCRESAEALATKLNKEN
• Gene Sequence: MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKEKCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQNHLEIEKTCRESAEALATKLNKEN
• Gene ID - Mouse: ENSMUSG00000041362
• Gene ID - Rat: ENSRNOG00000018350
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.