Anti SHMT2 pAb (ATL-HPA020549 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA020549-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: serine hydroxymethyltransferase 2 (mitochondrial)
Gene Name: SHMT2
Alternative Gene Name: SHMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025403: 95%, ENSRNOG00000008106: 95%
Entrez Gene ID: 6472
Uniprot ID: P34897
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen NTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAF
Gene Sequence NTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAF
Gene ID - Mouse ENSMUSG00000025403
Gene ID - Rat ENSRNOG00000008106
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SHMT2 pAb (ATL-HPA020549 w/enhanced validation)
Datasheet Anti SHMT2 pAb (ATL-HPA020549 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SHMT2 pAb (ATL-HPA020549 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SHMT2 pAb (ATL-HPA020549 w/enhanced validation)
Datasheet Anti SHMT2 pAb (ATL-HPA020549 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SHMT2 pAb (ATL-HPA020549 w/enhanced validation)
Citations for Anti SHMT2 pAb (ATL-HPA020549 w/enhanced validation) – 7 Found
Tiwari, Vivek; Daoud, Elena V; Hatanpaa, Kimmo J; Gao, Ang; Zhang, Song; An, Zhongxu; Ganji, Sandeep K; Raisanen, Jack M; Lewis, Cheryl M; Askari, Pegah; Baxter, Jeannie; Levy, Michael; Dimitrov, Ivan; Thomas, Binu P; Pinho, Marco C; Madden, Christopher J; Pan, Edward; Patel, Toral R; DeBerardinis, Ralph J; Sherry, A Dean; Mickey, Bruce E; Malloy, Craig R; Maher, Elizabeth A; Choi, Changho. Glycine by MR spectroscopy is an imaging biomarker of glioma aggressiveness. Neuro-Oncology. 2020;22(7):1018-1029.  PubMed
Soula, Mariluz; Weber, Ross A; Zilka, Omkar; Alwaseem, Hanan; La, Konnor; Yen, Frederick; Molina, Henrik; Garcia-Bermudez, Javier; Pratt, Derek A; Birsoy, Kıvanç. Metabolic determinants of cancer cell sensitivity to canonical ferroptosis inducers. Nature Chemical Biology. 2020;16(12):1351-1360.  PubMed
Kim, Dohoon; Fiske, Brian P; Birsoy, Kivanc; Freinkman, Elizaveta; Kami, Kenjiro; Possemato, Richard L; Chudnovsky, Yakov; Pacold, Michael E; Chen, Walter W; Cantor, Jason R; Shelton, Laura M; Gui, Dan Y; Kwon, Manjae; Ramkissoon, Shakti H; Ligon, Keith L; Kang, Seong Woo; Snuderl, Matija; Vander Heiden, Matthew G; Sabatini, David M. SHMT2 drives glioma cell survival in ischaemia but imposes a dependence on glycine clearance. Nature. 2015;520(7547):363-7.  PubMed
Pacold, Michael E; Brimacombe, Kyle R; Chan, Sze Ham; Rohde, Jason M; Lewis, Caroline A; Swier, Lotteke J Y M; Possemato, Richard; Chen, Walter W; Sullivan, Lucas B; Fiske, Brian P; Cho, Steve; Freinkman, Elizaveta; Birsoy, Kıvanç; Abu-Remaileh, Monther; Shaul, Yoav D; Liu, Chieh Min; Zhou, Minerva; Koh, Min Jung; Chung, Haeyoon; Davidson, Shawn M; Luengo, Alba; Wang, Amy Q; Xu, Xin; Yasgar, Adam; Liu, Li; Rai, Ganesha; Westover, Kenneth D; Vander Heiden, Matthew G; Shen, Min; Gray, Nathanael S; Boxer, Matthew B; Sabatini, David M. A PHGDH inhibitor reveals coordination of serine synthesis and one-carbon unit fate. Nature Chemical Biology. 2016;12(6):452-8.  PubMed
Lee, Yu Geon; Kim, Hui Won; Nam, Yeji; Shin, Kyeong Jin; Lee, Yu Jin; Park, Do Hong; Rhee, Hyun-Woo; Seo, Jeong Kon; Chae, Young Chan. LONP1 and ClpP cooperatively regulate mitochondrial proteostasis for cancer cell survival. Oncogenesis. 2021;10(2):18.  PubMed
Kiweler, Nicole; Delbrouck, Catherine; Pozdeev, Vitaly I; Neises, Laura; Soriano-Baguet, Leticia; Eiden, Kim; Xian, Feng; Benzarti, Mohaned; Haase, Lara; Koncina, Eric; Schmoetten, Maryse; Jaeger, Christian; Noman, Muhammad Zaeem; Vazquez, Alexei; Janji, Bassam; Dittmar, Gunnar; Brenner, Dirk; Letellier, Elisabeth; Meiser, Johannes. Mitochondria preserve an autarkic one-carbon cycle to confer growth-independent cancer cell migration and metastasis. Nature Communications. 2022;13(1):2699.  PubMed
Yao, Sha; Peng, Luogen; Elakad, Omar; Küffer, Stefan; Hinterthaner, Marc; Danner, Bernhard C; von Hammerstein-Equord, Alexander; Ströbel, Philipp; Bohnenberger, Hanibal. One carbon metabolism in human lung cancer. Translational Lung Cancer Research. 2021;10(6):2523-2538.  PubMed