Anti SHMT2 pAb (ATL-HPA020543 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020543-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SHMT2
Alternative Gene Name: SHMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025403: 90%, ENSRNOG00000008106: 88%
Entrez Gene ID: 6472
Uniprot ID: P34897
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEAL |
Gene Sequence | GQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEAL |
Gene ID - Mouse | ENSMUSG00000025403 |
Gene ID - Rat | ENSRNOG00000008106 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SHMT2 pAb (ATL-HPA020543 w/enhanced validation) | |
Datasheet | Anti SHMT2 pAb (ATL-HPA020543 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SHMT2 pAb (ATL-HPA020543 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SHMT2 pAb (ATL-HPA020543 w/enhanced validation) | |
Datasheet | Anti SHMT2 pAb (ATL-HPA020543 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SHMT2 pAb (ATL-HPA020543 w/enhanced validation) |
Citations for Anti SHMT2 pAb (ATL-HPA020543 w/enhanced validation) – 5 Found |
Kühl, Inge; Miranda, Maria; Atanassov, Ilian; Kuznetsova, Irina; Hinze, Yvonne; Mourier, Arnaud; Filipovska, Aleksandra; Larsson, Nils-Göran. Transcriptomic and proteomic landscape of mitochondrial dysfunction reveals secondary coenzyme Q deficiency in mammals. Elife. 2017;6( 29132502) PubMed |
Meiser, Johannes; Schuster, Anne; Pietzke, Matthias; Vande Voorde, Johan; Athineos, Dimitris; Oizel, Kristell; Burgos-Barragan, Guillermo; Wit, Niek; Dhayade, Sandeep; Morton, Jennifer P; Dornier, Emmanuel; Sumpton, David; Mackay, Gillian M; Blyth, Karen; Patel, Ketan J; Niclou, Simone P; Vazquez, Alexei. Increased formate overflow is a hallmark of oxidative cancer. Nature Communications. 2018;9(1):1368. PubMed |
Lucas, Stephanie; Chen, Guohua; Aras, Siddhesh; Wang, Jian. Serine catabolism is essential to maintain mitochondrial respiration in mammalian cells. Life Science Alliance. 2018;1(2):e201800036. PubMed |
Kjellin, Hanna; Johansson, Henrik; Höög, Anders; Lehtiö, Janne; Jakobsson, Per-Johan; Kjellman, Magnus. Differentially expressed proteins in malignant and benign adrenocortical tumors. Plos One. 9(2):e87951. PubMed |
Seo, Heewon; Bazer, Fuller W; Burghardt, Robert C; Johnson, Greg A. Immunohistochemical Examination of Trophoblast Syncytialization during Early Placentation in Sheep. International Journal Of Molecular Sciences. 2019;20(18) PubMed |