Anti SHMT1 pAb (ATL-HPA023314 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023314-25

Protein Description: serine hydroxymethyltransferase 1 (soluble)
Gene Name: SHMT1
Alternative Gene Name: CSHMT, MGC15229, MGC24556, SHMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020534: 78%, ENSRNOG00000005275: 75%
Entrez Gene ID: 6470
Uniprot ID: P34896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCL
• Gene Sequence: MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCL
• Gene ID - Mouse: ENSMUSG00000020534
• Gene ID - Rat: ENSRNOG00000005275
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SHMT1 pAb (ATL-HPA023314 w/enhanced validation) – 4 Found

Meiser, Johannes; Schuster, Anne; Pietzke, Matthias; Vande Voorde, Johan; Athineos, Dimitris; Oizel, Kristell; Burgos-Barragan, Guillermo; Wit, Niek; Dhayade, Sandeep; Morton, Jennifer P; Dornier, Emmanuel; Sumpton, David; Mackay, Gillian M; Blyth, Karen; Patel, Ketan J; Niclou, Simone P; Vazquez, Alexei. Increased formate overflow is a hallmark of oxidative cancer. Nature Communications. 2018;9(1):1368. 

Zgheib, Racha; Battaglia-Hsu, Shyue-Fang; Hergalant, Sébastien; Quéré, Maelle; Alberto, Jean-Marc; Chéry, Céline; Rouyer, Pierre; Gauchotte, Guillaume; Guéant, Jean-Louis; Namour, Farès. Folate can promote the methionine-dependent reprogramming of glioblastoma cells towards pluripotency. Cell Death & Disease. 2019;10(8):596. 

Nilsson, Lisa M; Forshell, Tacha Zi Plym; Rimpi, Sara; Kreutzer, Christiane; Pretsch, Walter; Bornkamm, Georg W; Nilsson, Jonas A. Mouse genetics suggests cell-context dependency for Myc-regulated metabolic enzymes during tumorigenesis. Plos Genetics. 8(3):e1002573. 

Kiweler, Nicole; Delbrouck, Catherine; Pozdeev, Vitaly I; Neises, Laura; Soriano-Baguet, Leticia; Eiden, Kim; Xian, Feng; Benzarti, Mohaned; Haase, Lara; Koncina, Eric; Schmoetten, Maryse; Jaeger, Christian; Noman, Muhammad Zaeem; Vazquez, Alexei; Janji, Bassam; Dittmar, Gunnar; Brenner, Dirk; Letellier, Elisabeth; Meiser, Johannes. Mitochondria preserve an autarkic one-carbon cycle to confer growth-independent cancer cell migration and metastasis. Nature Communications. 2022;13(1):2699.